ASB6 polyclonal antibody
  • ASB6 polyclonal antibody

ASB6 polyclonal antibody

Ref: AB-PAB31045
ASB6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human ASB6.
Información adicional
Size 100 uL
Gene Name ASB6
Gene Alias FLJ20548|MGC1024
Gene Description ankyrin repeat and SOCS box-containing 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq IIFEYQPLVDAILGSLGIQDPERQESLDRPSYVASEESRILVLTELLERKAHSPFYQEGVSNALLKMAELGLTRAADVLLRHGANLNFEDPVTYYTALHIAVLRNQPDMVELLVHHGADVNRRD
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-200)
Western Blot (1:100-250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human ASB6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 140459
Iso type IgG

Enviar un mensaje


ASB6 polyclonal antibody

ASB6 polyclonal antibody