SYT16 polyclonal antibody
  • SYT16 polyclonal antibody

SYT16 polyclonal antibody

Ref: AB-PAB31038
SYT16 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human SYT16.
Información adicional
Size 100 uL
Gene Name SYT16
Gene Alias CHR14SYT|SYT14L|Strep14|syt14r|yt14r
Gene Description synaptotagmin XVI
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq TRERMMGEKLFYLSHLHPEGEMKVTLVLEPRSNISSGGSPLSPSAVSHSDSTSSTQSLSHGGAPELLVGLSYNATTGRLSVEMIKGSHFRNLAVNRAPDTYGKLFLLNSVGQEMSRCKTSIRRGQPNPVYKETFVFQVALFQLSDVTLM
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-200)
Western Blot (1:100-250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human SYT16.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 83851
Iso type IgG

Enviar un mensaje


SYT16 polyclonal antibody

SYT16 polyclonal antibody