IL18 polyclonal antibody
  • IL18 polyclonal antibody

IL18 polyclonal antibody

Ref: AB-PAB31027
IL18 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human IL18.
Información adicional
Size 100 uL
Gene Name IL18
Gene Alias IGIF|IL-18|IL-1g|IL1F4|MGC12320
Gene Description interleukin 18 (interferon-gamma-inducing factor)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,IHC-P,IF
Immunogen Prot. Seq MAAEPVEDNCINFVAMKFIDNTLYFIAEDDENLESDYFGKLESKLSVIRNLNDQVLFIDQGNRPLFEDMTDSDCRDNAPRTIFIISMYKDSQPRGMAVTISVKCEKISTLSCENKIISFKEMNPPDNIKDTKSDIIFFQRSVPGHDNKMQF
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-500)
Western Blot (1:100-250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human IL18.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 3606
Iso type IgG

Enviar un mensaje


IL18 polyclonal antibody

IL18 polyclonal antibody