ASB3 polyclonal antibody
  • ASB3 polyclonal antibody

ASB3 polyclonal antibody

Ref: AB-PAB31025
ASB3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human ASB3.
Información adicional
Size 100 uL
Gene Name ASB3
Gene Alias ASB-3|FLJ10123|FLJ10421|MGC12531|MGC132002|MGC996
Gene Description ankyrin repeat and SOCS box-containing 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LHQASFQENAEIIKLLLRKGANKECQDDFGITPLFVAAQYGKLESLSILISSGANVNCQALDKATPLFIAAQEGHTKCVELLLSSGADPDLYCNEDSWQLPIHAAAQMGHTKILDLLIPLTNRACDTGLNKV
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human ASB3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 51130
Iso type IgG

Enviar un mensaje


ASB3 polyclonal antibody

ASB3 polyclonal antibody