RARRES1 polyclonal antibody
  • RARRES1 polyclonal antibody

RARRES1 polyclonal antibody

Ref: AB-PAB31020
RARRES1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human RARRES1.
Información adicional
Size 100 uL
Gene Name RARRES1
Gene Alias TIG1
Gene Description retinoic acid receptor responder (tazarotene induced) 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VVFSTERYNPESLLQEGEGRLGKCSARVFFKNQKPRPTINVTCTRLIEKKKRQQEDYLLYKQMKQLKNPLEIVSIPDNHGHIDPSLRLIW
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human RARRES1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 5918
Iso type IgG

Enviar un mensaje


RARRES1 polyclonal antibody

RARRES1 polyclonal antibody