RSPRY1 polyclonal antibody
  • RSPRY1 polyclonal antibody

RSPRY1 polyclonal antibody

Ref: AB-PAB31015
RSPRY1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human RSPRY1.
Información adicional
Size 100 uL
Gene Name RSPRY1
Gene Alias KIAA1972
Gene Description ring finger and SPRY domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq GRGPHEPRRKKQNVDGLVLDTLAVIRTLVDNDQEPPYSMITLHEMAETDEGWLDVVQSLIRVIPLEDPLGPAVITLLLDECPLPTKDALQKLTEILNLNGEVACQDSSHPAKHRNTSAVLGCLAEKLAGPASIGLLSPGILEYLLQC
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-200)
Western Blot (1:100-250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human RSPRY1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 89970
Iso type IgG

Enviar un mensaje


RSPRY1 polyclonal antibody

RSPRY1 polyclonal antibody