ITGA5 polyclonal antibody
  • ITGA5 polyclonal antibody

ITGA5 polyclonal antibody

Ref: AB-PAB31001
ITGA5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human ITGA5.
Información adicional
Size 100 uL
Gene Name ITGA5
Gene Alias CD49e|FNRA|VLA5A
Gene Description integrin, alpha 5 (fibronectin receptor, alpha polypeptide)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq DQPQKEEDLGPAVHHVYELINQGPSSISQGVLELSCPQALEGQQLLYVTRVTGLNCTTNHPINPKGLELDPEGSLHHQQKREAPSRSSASSGPQILKCPEAECFRLRCELGPLHQQESQSLQLHFRVWA
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human ITGA5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 3678
Iso type IgG

Enviar un mensaje


ITGA5 polyclonal antibody

ITGA5 polyclonal antibody