UBXN11 polyclonal antibody
  • UBXN11 polyclonal antibody

UBXN11 polyclonal antibody

Ref: AB-PAB30994
UBXN11 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human UBXN11.
Información adicional
Size 100 uL
Gene Name UBXN11
Gene Alias COA-1|DKFZp686F04228|PP2243|SOC|SOCI|UBXD5
Gene Description UBX domain protein 11
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SENGEQAFLLMMQPDNTIGDVRALLAQARVMDASAFEIFSTFPPTLYQDDTLTLQAAGLVPKAALLLRARRAPKSSLKFSPGP
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human UBXN11.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 91544
Iso type IgG

Enviar un mensaje


UBXN11 polyclonal antibody

UBXN11 polyclonal antibody