MATN1 polyclonal antibody
  • MATN1 polyclonal antibody

MATN1 polyclonal antibody

Ref: AB-PAB30991
MATN1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human MATN1.
Información adicional
Size 100 uL
Gene Name MATN1
Gene Alias CMP|CRTM
Gene Description matrilin 1, cartilage matrix protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq REIASEPVAEHYFYTADFKTINQIGKKLQKKICVEEDPCACESLVKFQAKVEGLLQALTRKLEAVSKRLAILENTVV
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human MATN1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 4146
Iso type IgG

Enviar un mensaje


MATN1 polyclonal antibody

MATN1 polyclonal antibody