SPTA1 polyclonal antibody
  • SPTA1 polyclonal antibody

SPTA1 polyclonal antibody

Ref: AB-PAB30985
SPTA1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human SPTA1.
Información adicional
Size 100 uL
Gene Name SPTA1
Gene Alias EL2|SPTA
Gene Description spectrin, alpha, erythrocytic 1 (elliptocytosis 2)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq HQGIVPAVYVRRLAHDEFPMLPQRRREEPGNITQRQEQIENQYRSLLDRAEERRRRLLQRYNEFLLAYEAGDMLEWIQEKKAENTGVEL
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human SPTA1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 6708
Iso type IgG

Enviar un mensaje


SPTA1 polyclonal antibody

SPTA1 polyclonal antibody