RXFP3 polyclonal antibody
  • RXFP3 polyclonal antibody

RXFP3 polyclonal antibody

Ref: AB-PAB30983
RXFP3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human RXFP3.
Información adicional
Size 100 uL
Gene Name RXFP3
Gene Alias GPCR135|MGC141998|MGC142000|RLN3R1|RXFPR3|SALPR
Gene Description relaxin/insulin-like family peptide receptor 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MQMADAATIATMNKAAGGDKLAELFSLVPDLLEAANTSGNASLQLPDLWWELGLELPDG
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human RXFP3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 51289
Iso type IgG

Enviar un mensaje


RXFP3 polyclonal antibody

RXFP3 polyclonal antibody