BMP2K polyclonal antibody
  • BMP2K polyclonal antibody

BMP2K polyclonal antibody

Ref: AB-PAB30959
BMP2K polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human BMP2K.
Información adicional
Size 100 uL
Gene Name BMP2K
Gene Alias BIKE|DKFZp434K0614|DKFZp434P0116|HRIHFB2017
Gene Description BMP2 inducible kinase
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq FISHSGSPEKKAEHSSINQENGTANPIKNGKTSPASKDQRTGKKTSVQGQVQKGNDESESDFESDPPSPKSSEEEEQDDEEV
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human BMP2K.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 55589
Iso type IgG

Enviar un mensaje


BMP2K polyclonal antibody

BMP2K polyclonal antibody