PRKCH polyclonal antibody
  • PRKCH polyclonal antibody

PRKCH polyclonal antibody

Ref: AB-PAB30958
PRKCH polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human PRKCH.
Información adicional
Size 100 uL
Gene Name PRKCH
Gene Alias MGC26269|MGC5363|PKC-L|PKCL|PRKCL|nPKC-eta
Gene Description protein kinase C, eta
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq FKEIDWAQLNHRQIEPPFRPRIKSREDVSNFDPDFIKEEPVLTPIDEGHLPMINQDEFRNF
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human PRKCH.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 5583
Iso type IgG

Enviar un mensaje


PRKCH polyclonal antibody

PRKCH polyclonal antibody