CAMK2D polyclonal antibody
  • CAMK2D polyclonal antibody

CAMK2D polyclonal antibody

Ref: AB-PAB30957
CAMK2D polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human CAMK2D.
Información adicional
Size 100 uL
Gene Name CAMK2D
Gene Alias CAMKD|DKFZp686G23119|DKFZp686I2288|MGC44911
Gene Description calcium/calmodulin-dependent protein kinase II delta
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTVPIKPPCIPNGKENFSGGTSLWQ
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human CAMK2D.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 817
Iso type IgG

Enviar un mensaje


CAMK2D polyclonal antibody

CAMK2D polyclonal antibody