CD22 polyclonal antibody
  • CD22 polyclonal antibody

CD22 polyclonal antibody

Ref: AB-PAB30950
CD22 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human CD22.
Información adicional
Size 100 uL
Gene Name CD22
Gene Alias FLJ22814|MGC130020|SIGLEC-2|SIGLEC2
Gene Description CD22 molecule
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DLESFILFHNPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLRMESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLL
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human CD22.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 933
Iso type IgG

Enviar un mensaje


CD22 polyclonal antibody

CD22 polyclonal antibody