SYVN1 polyclonal antibody
  • SYVN1 polyclonal antibody

SYVN1 polyclonal antibody

Ref: AB-PAB30947
SYVN1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human SYVN1.
Información adicional
Size 100 uL
Gene Name SYVN1
Gene Alias HRD1|KIAA1810|MGC40372
Gene Description synovial apoptosis inhibitor 1, synoviolin
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq HTFPLFAIRPMYLAMRQFKKAVTDAIMSRRAIRNMNTLYPDATPEELQAMDNVCIICREEMVTGAKRLPCNHIFHTSCLRSWFQRQQTCPTCRMDVLRASLPAQSPPPPEPADQGP
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human SYVN1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 84447
Iso type IgG

Enviar un mensaje


SYVN1 polyclonal antibody

SYVN1 polyclonal antibody