ITCH polyclonal antibody
  • ITCH polyclonal antibody

ITCH polyclonal antibody

Ref: AB-PAB30919
ITCH polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human ITCH.
Información adicional
Size 100 uL
Gene Name ITCH
Gene Alias AIF4|AIP4|NAPP1|dJ468O1.1
Gene Description itchy E3 ubiquitin protein ligase homolog (mouse)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LKSDVLLGTAALDIYETLKSNNMKLEEVVVTLQLGGDKEPTETIGDLSICLDGLQLESEVVTNGETTCSENGVSLCLP
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human ITCH.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 83737
Iso type IgG

Enviar un mensaje


ITCH polyclonal antibody

ITCH polyclonal antibody