SCYL2 polyclonal antibody
  • SCYL2 polyclonal antibody

SCYL2 polyclonal antibody

Ref: AB-PAB30917
SCYL2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human SCYL2.
Información adicional
Size 100 uL
Gene Name SCYL2
Gene Alias CVAK104|FLJ10074|KIAA1360
Gene Description SCY1-like 2 (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LNVTPTVRPDADQMTKIPFFDDVGAVTLQYFDTLFQRDNLQKSQFFKGLPKVLPKLPKRVIVQRILPCLTSEFVNPDMVPFVLPNVLLIAEECTKEEYVKLILPELGPVFKQQEPIQILLIFLQKMDLLLTKTPPDEIKNS
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human SCYL2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 55681
Iso type IgG

Enviar un mensaje


SCYL2 polyclonal antibody

SCYL2 polyclonal antibody