SVOP polyclonal antibody
  • SVOP polyclonal antibody

SVOP polyclonal antibody

Ref: AB-PAB30881
SVOP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human SVOP.
Información adicional
Size 100 uL
Gene Name SVOP
Gene Alias DKFZp761H039
Gene Description SV2 related protein homolog (rat)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LPIETKGRGLQESSHREWGQEMVGRGMHGAGVTRSNSGSQE
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human SVOP.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 55530
Iso type IgG

Enviar un mensaje


SVOP polyclonal antibody

SVOP polyclonal antibody