ITPR1 polyclonal antibody
  • ITPR1 polyclonal antibody

ITPR1 polyclonal antibody

Ref: AB-PAB30879
ITPR1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human ITPR1.
Información adicional
Size 100 uL
Gene Name ITPR1
Gene Alias INSP3R1|IP3R|IP3R1|SCA15|SCA16
Gene Description inositol 1,4,5-triphosphate receptor, type 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq FFKVFYDRMKVAQQEIKATVTVNTSDLGNKKKDDEVDRDAPSRKKAKEPTTQITEEVRDQLLEASAATRKAFTTFRREADPDDHYQPGEGTQATADKAKDDLEMSAVITIMQPILRFLQLLCENHNRDLQNFLRC
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human ITPR1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 3708
Iso type IgG

Enviar un mensaje


ITPR1 polyclonal antibody

ITPR1 polyclonal antibody