BAD polyclonal antibody
  • BAD polyclonal antibody

BAD polyclonal antibody

Ref: AB-PAB30871
BAD polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human BAD.
Información adicional
Size 100 uL
Gene Name BAD
Gene Alias BBC2|BCL2L8
Gene Description BCL2-associated agonist of cell death
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq QEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMG
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human BAD.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 572
Iso type IgG

Enviar un mensaje


BAD polyclonal antibody

BAD polyclonal antibody