CREB3L1 polyclonal antibody
  • CREB3L1 polyclonal antibody

CREB3L1 polyclonal antibody

Ref: AB-PAB30868
CREB3L1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human CREB3L1.
Información adicional
Size 100 uL
Gene Name CREB3L1
Gene Alias OASIS
Gene Description cAMP responsive element binding protein 3-like 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LNESDFLNNAHFPEHLDHFTENMEDFSNDLFSSFFDDPVLDEKSPLLDMELDSPTPGIQAEHSYSLSGDSAPQSPLVPIKMEDTTQDAEHGAWALGHKLCSIMVKQE
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human CREB3L1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 90993
Iso type IgG

Enviar un mensaje


CREB3L1 polyclonal antibody

CREB3L1 polyclonal antibody