RAF1 polyclonal antibody
  • RAF1 polyclonal antibody

RAF1 polyclonal antibody

Ref: AB-PAB30864
RAF1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human RAF1.
Información adicional
Size 100 uL
Gene Name RAF1
Gene Alias CRAF|NS5|Raf-1|c-Raf
Gene Description v-raf-1 murine leukemia viral oncogene homolog 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq FRCQTCGYKFHEHCSTKVPTMCVDWSNIRQLLLFPNSTIGDSGVPALPSLTMRRMRESVSRMPVSSQHRYSTPHAFTFNTSSPSSEGSLSQRQRSTSTPNVHMVSTTLPVDSRMIEDAIRSHSESASPSALSSSPNNLSPTGWSQ
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human RAF1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 5894
Iso type IgG

Enviar un mensaje


RAF1 polyclonal antibody

RAF1 polyclonal antibody