UBE2J1 polyclonal antibody
  • UBE2J1 polyclonal antibody

UBE2J1 polyclonal antibody

Ref: AB-PAB30863
UBE2J1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human UBE2J1.
Información adicional
Size 100 uL
Gene Name UBE2J1
Gene Alias CGI-76|HSPC153|HSPC205|HSU93243|MGC12555|NCUBE1|Ubc6p
Gene Description ubiquitin-conjugating enzyme E2, J1 (UBC6 homolog, yeast)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq VLLPLKSGSDSSQADQEAKELARQISFKAEVNSSGKTISESDLNHSFSLTDLQDDIPTTFQGATASTSYGLQNSSAASFHQPTQPVAKNTSMSPRQRRAQQQSQRRLSTSPDVIQGHQPRDNHTD
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-500)
Western Blot (1:100-250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human UBE2J1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 51465
Iso type IgG

Enviar un mensaje


UBE2J1 polyclonal antibody

UBE2J1 polyclonal antibody