SNRPB polyclonal antibody
  • SNRPB polyclonal antibody

SNRPB polyclonal antibody

Ref: AB-PAB30861
SNRPB polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human SNRPB.
Información adicional
Size 100 uL
Gene Name SNRPB
Gene Alias COD|SNRPB1|SmB/SmB'|snRNP-B
Gene Description small nuclear ribonucleoprotein polypeptides B and B1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq TFKAFDKHMNLILCDCDEFRKIKPKNAKQPEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGVGRAAGRGVPAGVPIPQ
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-50)
Western Blot (1:100-250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human SNRPB.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 6628
Iso type IgG

Enviar un mensaje


SNRPB polyclonal antibody

SNRPB polyclonal antibody