RHOXF2 polyclonal antibody
  • RHOXF2 polyclonal antibody

RHOXF2 polyclonal antibody

Ref: AB-PAB30850
RHOXF2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human RHOXF2.
Información adicional
Size 100 uL
Gene Name RHOXF2
Gene Alias PEPP-2|PEPP2|THG1
Gene Description Rhox homeobox family, member 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq DQCSQYMTSLLSPAVDDEKELQDMNAMVLSLTEEVKEEEEDAQPEPEQGTAAGEKLKSAGAQGGEEKDGGGEEKDGGGAGVPGHLWEGDLEGTSGSDGNVEDSDQSEKEPGQQ
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-500)
Western Blot (1:100-250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human RHOXF2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 84528
Iso type IgG

Enviar un mensaje


RHOXF2 polyclonal antibody

RHOXF2 polyclonal antibody