ARIH1 polyclonal antibody
  • ARIH1 polyclonal antibody

ARIH1 polyclonal antibody

Ref: AB-PAB30848
ARIH1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human ARIH1.
Información adicional
Size 100 uL
Gene Name ARIH1
Gene Alias ARI|DKFZp686O13120|FLJ20329|FLJ93118|HARI|HHARI|UBCH7BP
Gene Description ariadne homolog, ubiquitin-conjugating enzyme E2 binding protein, 1 (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq LQHMVECIREVNEVIQNPATITRILLSHFNWDKEKLMERYFDGNLEKLFAECHVINPSKKSRTRQMNTRSSAQDMPCQICYLNYPNSYFTGLECGHKFCMQCWSEYLTTKIMEEGMGQTISCPAHGCDILVDDNTVMRLITDSKVK
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-50)
Western Blot (1:100-250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human ARIH1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 25820
Iso type IgG

Enviar un mensaje


ARIH1 polyclonal antibody

ARIH1 polyclonal antibody