TNFRSF13C polyclonal antibody
  • TNFRSF13C polyclonal antibody

TNFRSF13C polyclonal antibody

Ref: AB-PAB30845
TNFRSF13C polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human TNFRSF13C.
Información adicional
Size 100 uL
Gene Name TNFRSF13C
Gene Alias BAFF-R|BAFFR|CD268|MGC138235
Gene Description tumor necrosis factor receptor superfamily, member 13C
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq SWRRRQRRLRGASSAEAPDGDKDAPEPLDKVIILSPGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAGPEQQ
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-200)
Western Blot (1:100-250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human TNFRSF13C.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 115650
Iso type IgG

Enviar un mensaje


TNFRSF13C polyclonal antibody

TNFRSF13C polyclonal antibody