ZAP70 polyclonal antibody
  • ZAP70 polyclonal antibody

ZAP70 polyclonal antibody

Ref: AB-PAB30842
ZAP70 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human ZAP70.
Información adicional
Size 100 uL
Gene Name ZAP70
Gene Alias FLJ17670|FLJ17679|SRK|STD|TZK|ZAP-70
Gene Description zeta-chain (TCR) associated protein kinase 70kDa
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq LIYCLKEACPNSSASNASGAAAPTLPAHPSTLTHPQRRIDTLNSDGYTPEPARITSPDKPRPMPMDTSVYESPYSDPEELKDKKLFLKRDNLLIADIELGCGNFGSVRQGVYRMRKKQIDVAIKVLKQGTEKADTEEMMR
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-500)
Western Blot (1:100-250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human ZAP70.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 7535
Iso type IgG

Enviar un mensaje


ZAP70 polyclonal antibody

ZAP70 polyclonal antibody