RBX1 polyclonal antibody
  • RBX1 polyclonal antibody

RBX1 polyclonal antibody

Ref: AB-PAB30841
RBX1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human RBX1.
Información adicional
Size 100 uL
Gene Name RBX1
Gene Alias BA554C12.1|MGC13357|MGC1481|RNF75|ROC1
Gene Description ring-box 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEF
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-200)
Western Blot (1:100-250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human RBX1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 9978
Iso type IgG

Enviar un mensaje


RBX1 polyclonal antibody

RBX1 polyclonal antibody