NACC1 polyclonal antibody
  • NACC1 polyclonal antibody

NACC1 polyclonal antibody

Ref: AB-PAB30812
NACC1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human NACC1.
Información adicional
Size 100 uL
Gene Name NACC1
Gene Alias BEND8|BTBD14B|FLJ37383|NAC-1|NAC1
Gene Description nucleus accumbens associated 1, BEN and BTB (POZ) domain containing
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq PGSYHNEEDEEEDGGEEGMDEQYRQICNMYTMYSMMNVGQTAEKVEALPEQVAPESRNRIRVRQDLASLPAELINQIGNRCH
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human NACC1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 112939
Iso type IgG

Enviar un mensaje


NACC1 polyclonal antibody

NACC1 polyclonal antibody