COL6A1 polyclonal antibody
  • COL6A1 polyclonal antibody

COL6A1 polyclonal antibody

Ref: AB-PAB30805
COL6A1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human COL6A1.
Información adicional
Size 100 uL
Gene Name COL6A1
Gene Alias OPLL
Gene Description collagen, type VI, alpha 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq VSVGIKDVFDFIPGSDQLNVISCQGLAPSQGRPGLSLVKENYAELLEDAFLKNVTAQICIDKKCPDYTCPITFSSPADITILLD
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human COL6A1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 1291
Iso type IgG

Enviar un mensaje


COL6A1 polyclonal antibody

COL6A1 polyclonal antibody