MIB1 polyclonal antibody
  • MIB1 polyclonal antibody

MIB1 polyclonal antibody

Ref: AB-PAB30803
MIB1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human MIB1.
Información adicional
Size 100 uL
Gene Name MIB1
Gene Alias DIP-1|DKFZp686I0769|DKFZp761M1710|FLJ90676|MGC129659|MGC129660|MIB|ZZANK2|ZZZ6
Gene Description mindbomb homolog 1 (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq LDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANIVRSGDAAQGAEGGTSQFQVGDLVQVCYDLERIKLLQRGHGEWAEAM
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human MIB1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 57534
Iso type IgG

Enviar un mensaje


MIB1 polyclonal antibody

MIB1 polyclonal antibody