SPTAN1 polyclonal antibody
  • SPTAN1 polyclonal antibody

SPTAN1 polyclonal antibody

Ref: AB-PAB30787
SPTAN1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human SPTAN1.
Información adicional
Size 100 uL
Gene Name SPTAN1
Gene Alias (ALPHA)II-SPECTRIN|FLJ44613|NEAS
Gene Description spectrin, alpha, non-erythrocytic 1 (alpha-fodrin)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq HQEFKSCLRSLGYDLPMVEEGEPDPEFEAILDTVDPNRDGHVSLQEYMAFMISRETENVKSSEEIESAFRALSSEGKPYVTKEELYQNLTREQADYCVSHMKPYVDGKGRELPTAFDYVEFTRSLF
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human SPTAN1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 6709
Iso type IgG

Enviar un mensaje


SPTAN1 polyclonal antibody

SPTAN1 polyclonal antibody