PNCK polyclonal antibody
  • PNCK polyclonal antibody

PNCK polyclonal antibody

Ref: AB-PAB30780
PNCK polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human PNCK.
Información adicional
Size 100 uL
Gene Name PNCK
Gene Alias BSTK3|CaMK1b|FLJ50403|FLJ50549|FLJ56451|FLJ59811|MGC45419
Gene Description pregnancy up-regulated non-ubiquitously expressed CaM kinase
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq MLLLKKHTEDISSVYEIRERLGSGAFSEVVLAQERGSAHLVALKCIPKKALRGKEALVENEIAVLRRISHPN
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human PNCK.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 139728
Iso type IgG

Enviar un mensaje


PNCK polyclonal antibody

PNCK polyclonal antibody