MAP3K10 polyclonal antibody
  • MAP3K10 polyclonal antibody

MAP3K10 polyclonal antibody

Ref: AB-PAB30773
MAP3K10 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human MAP3K10.
Información adicional
Size 100 uL
Gene Name MAP3K10
Gene Alias MLK2|MST
Gene Description mitogen-activated protein kinase kinase kinase 10
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq LPSGFEHKITVQASPTLDKRKGSDGASPPASPSIIPRLRAIRLTPVDCGGSSSGSSSGGSGTWSRGGPPKKEELVGGKKKGRTWGPSSTLQKERVGGEERLKGLGEGSKQWSSS
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human MAP3K10.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 4294
Iso type IgG

Enviar un mensaje


MAP3K10 polyclonal antibody

MAP3K10 polyclonal antibody