USP5 polyclonal antibody
  • USP5 polyclonal antibody

USP5 polyclonal antibody

Ref: AB-PAB30765
USP5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human USP5.
Información adicional
Size 100 uL
Gene Name USP5
Gene Alias ISOT
Gene Description ubiquitin specific peptidase 5 (isopeptidase T)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P,IF
Immunogen Prot. Seq YVDKLEKIFQNAPTDPTQDFSTQVAKLGHGLLSGEYSKPVPESGDGERVPEQKEVQDGIAPRMFKALIGKGHPEFSTNRQQDAQEFFLHLINMVERNCRSSENPNEVF
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human USP5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 8078
Iso type IgG

Enviar un mensaje


USP5 polyclonal antibody

USP5 polyclonal antibody