RAD9A polyclonal antibody
  • RAD9A polyclonal antibody

RAD9A polyclonal antibody

Ref: AB-PAB30763
RAD9A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human RAD9A.
Información adicional
Size 100 uL
Gene Name RAD9A
Gene Alias RAD9
Gene Description RAD9 homolog A (S. pombe)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq AIFTIKDSLLDGHFVLATLSDTDSHSQDLGSPERHQPVPQLQAHSTPHPDDFANDDIDSYMIAMETTIGNEGSRVLPSISLSPGPQPPKSPGPHSEEEDEAEPSTVPGTPPPKKFRSLFFGSILAPV
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human RAD9A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 5883
Iso type IgG

Enviar un mensaje


RAD9A polyclonal antibody

RAD9A polyclonal antibody