MED4 polyclonal antibody
  • MED4 polyclonal antibody

MED4 polyclonal antibody

Ref: AB-PAB30755
MED4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human MED4.
Información adicional
Size 100 uL
Gene Name MED4
Gene Alias DRIP36|FLJ10956|HSPC126|RP11-90M2.2|TRAP36|VDRIP
Gene Description mediator complex subunit 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq SGEKEKERLGGGLGVAGGNSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQAGEENQVLELLIHRDGEFQELMKLALNQGKIHHEMQVLEKEVEKRDSDIQQLQKQLKEAEQI
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human MED4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 29079
Iso type IgG

Enviar un mensaje


MED4 polyclonal antibody

MED4 polyclonal antibody