ZNF608 polyclonal antibody
  • ZNF608 polyclonal antibody

ZNF608 polyclonal antibody

Ref: AB-PAB30743
ZNF608 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human ZNF608.
Información adicional
Size 100 uL
Gene Name ZNF608
Gene Alias DKFZp781C0723|MGC166851|NY-REN-36
Gene Description zinc finger protein 608
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq PPGTPKGKRELMSNGPGSIIGAKAGKNSGKKKGLNNELNNLPVISNMTAALDSCSAADGSLAAEMPKLEAEGLIDKKNLGDKEKGKKATNCKTDKNLSKLKSARPIAPAPAPTPPQLIAIPTATFTTTTTGTIPGLPSLTTTVVQATP
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human ZNF608.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 57507
Iso type IgG

Enviar un mensaje


ZNF608 polyclonal antibody

ZNF608 polyclonal antibody