TPX2 polyclonal antibody
  • TPX2 polyclonal antibody

TPX2 polyclonal antibody

Ref: AB-PAB30737
TPX2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human TPX2.
Información adicional
Size 100 uL
Gene Name TPX2
Gene Alias C20orf1|C20orf2|DIL-2|DIL2|FLS353|GD:C20orf1|HCA519|HCTP4|REPP86|p100
Gene Description TPX2, microtubule-associated, homolog (Xenopus laevis)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq QELEKSMKMQQEVVEMRKKNEEFKKLALAGIGQPVKKSVSQVTKSVDFHFRTDERIKQHPKNQEEYKEVNFTSELRKHPSSPARVTKGCTIVKPFNLSQGKKRTFDETVSTYVPLAQQVEDFHKRTPNRYHLRSKKD
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human TPX2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 22974
Iso type IgG

Enviar un mensaje


TPX2 polyclonal antibody

TPX2 polyclonal antibody