CBX3 polyclonal antibody
  • CBX3 polyclonal antibody

CBX3 polyclonal antibody

Ref: AB-PAB30722
CBX3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human CBX3.
Información adicional
Size 100 uL
Gene Name CBX3
Gene Alias HECH|HP1-GAMMA|HP1Hs-gamma
Gene Description chromobox homolog 3 (HP1 gamma homolog, Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq RVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEA
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human CBX3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 11335
Iso type IgG

Enviar un mensaje


CBX3 polyclonal antibody

CBX3 polyclonal antibody