GTF2H3 polyclonal antibody
  • GTF2H3 polyclonal antibody

GTF2H3 polyclonal antibody

Ref: AB-PAB30716
GTF2H3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human GTF2H3.
Información adicional
Size 100 uL
Gene Name GTF2H3
Gene Alias BTF2|TFB4|TFIIH
Gene Description general transcription factor IIH, polypeptide 3, 34kDa
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq LNLLVIVVDANPIWWGKQALKESQFTLSKCIDAVMVLGNSHLFMNRSNKLAVIASHIQESRFLYPGKNGRLGDFFGDPGNPPEFNPSGSKDGKYELLTSANEVIVEEIKDLMTKSDIKGQHTETLLAG
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human GTF2H3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 2967
Iso type IgG

Enviar un mensaje


GTF2H3 polyclonal antibody

GTF2H3 polyclonal antibody