ZYX polyclonal antibody
  • ZYX polyclonal antibody

ZYX polyclonal antibody

Ref: AB-PAB30715
100 uL

Información del producto

ZYX polyclonal antibody
Información adicional
Size 100 uL
Gene Name ZYX
Gene Alias ESP-2|HED-2
Gene Description zyxin
Storage Conditions Store at 4C. For long term storage store at -20C.Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq PAPKFSPVTPKFTPVASKFSPGAPGGSGSQPNQKLGHPEALSAGTGSPQPPSFTYAQQREKPRVQEKQHPVPPPAQNQNQVRSPGAPGPLTLKEVEELEQLTQQLMQDMEHPQRQNVAVNE
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human ZYX.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 7791
Iso type IgG

Enviar un mensaje


ZYX polyclonal antibody

ZYX polyclonal antibody