USP13 polyclonal antibody
  • USP13 polyclonal antibody

USP13 polyclonal antibody

Ref: AB-PAB30714
USP13 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human USP13.
Información adicional
Size 100 uL
Gene Name USP13
Gene Alias ISOT3|IsoT-3
Gene Description ubiquitin specific peptidase 13 (isopeptidase T-3)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq RKAVYFTGNMGAEVAFNWIIVHMEEPDFAEPLTMPGYGGAASAGASVFGASGLDNQPPEEIVAIITSMGFQRNQAIQALRATNNNLERALDWIFSHPEFEEDSDFVIEMENNANANIISEAKPEGPRVKDGSGTYELFAFISH
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human USP13.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 8975
Iso type IgG

Enviar un mensaje


USP13 polyclonal antibody

USP13 polyclonal antibody