ILKAP polyclonal antibody
  • ILKAP polyclonal antibody

ILKAP polyclonal antibody

Ref: AB-PAB30705
ILKAP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human ILKAP.
Información adicional
Size 100 uL
Gene Name ILKAP
Gene Alias DKFZp434J2031|FLJ10181|MGC4846|PP2C-DELTA
Gene Description integrin-linked kinase-associated serine/threonine phosphatase 2C
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq PLLFDDLPPASSTDSGSGGPLLFDDLPPASSGDSGSLATSISQMVKTEGKGAKRKTSEEEKNGSEELVEKKVCKASSVIFGLKGYVAERKGEREEMQDAHV
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human ILKAP.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 80895
Iso type IgG

Enviar un mensaje


ILKAP polyclonal antibody

ILKAP polyclonal antibody