FLNB polyclonal antibody
  • FLNB polyclonal antibody

FLNB polyclonal antibody

Ref: AB-PAB30702
FLNB polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human FLNB.
Información adicional
Size 100 uL
Gene Name FLNB
Gene Alias ABP-278|AOI|DKFZp686A1668|DKFZp686O033|FH1|FLN1L|LRS1|SCT|TABP|TAP
Gene Description filamin B, beta (actin binding protein 278)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P,IF
Immunogen Prot. Seq KEPGEYAVHIMCDDEDIKDSPYMAFIHPATGGYNPDLVRAYGPGLEKSGCIVNNLAEFTVDPKDAGKAPLKIFAQDGEGQRIDIQMKNRMDGTYACSYTPVKAIKHTIAVVWG
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human FLNB.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 2317
Iso type IgG

Enviar un mensaje


FLNB polyclonal antibody

FLNB polyclonal antibody