TAF10 polyclonal antibody
  • TAF10 polyclonal antibody

TAF10 polyclonal antibody

Ref: AB-PAB30678
TAF10 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human TAF10.
Información adicional
Size 100 uL
Gene Name TAF10
Gene Alias TAF2A|TAF2H|TAFII30
Gene Description TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq SNGVYVLPSAANGDVKPVVSSTPLVDFLMQLEDYTPTIPDAVTGYYLNRAGFEASDPRIIRLISLAAQKFISDIANDALQHCKMKGTASGSSRSKSKDRKYTLTMEDLTPALSEYGINVKKP
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human TAF10.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 6881
Iso type IgG

Enviar un mensaje


TAF10 polyclonal antibody

TAF10 polyclonal antibody