RBM23 polyclonal antibody
  • RBM23 polyclonal antibody

RBM23 polyclonal antibody

Ref: AB-PAB30676
RBM23 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human RBM23.
Información adicional
Size 100 uL
Gene Name RBM23
Gene Alias CAPERbeta|FLJ10482|MGC4458|PP239|RNPC4
Gene Description RNA binding motif protein 23
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq MASDDFDIVIEAMLEAPYKKEEDEQQRKEVKKDYPSNTTSSTSNSGNETSGSSTIGETSNRSRDRDRYRRRNSRSRSPGRQCRHRSRSWDRRHGSESRSRDHRREDRVHYRSPPLATGYRYGHSKSPHFREKSP
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human RBM23.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 55147
Iso type IgG

Enviar un mensaje


RBM23 polyclonal antibody

RBM23 polyclonal antibody