MLLT6 polyclonal antibody
  • MLLT6 polyclonal antibody

MLLT6 polyclonal antibody

Ref: AB-PAB30665
MLLT6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human MLLT6.
Información adicional
Size 100 uL
Gene Name MLLT6
Gene Alias AF17|FLJ23480
Gene Description myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq PSAPPSPSAPEPPKADLFEQKVVFSGFGPIMRFSTTTSSSGRARAPSPGDYKSPHVTGSGASAGTHKRMPALSATPVPADETPETGLKEKKHKASKRSRHGPGRPKGSRNKEGTGGPAAPSLPSAQLAGFTATAASPFSGGSLVSS
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human MLLT6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 4302
Iso type IgG

Enviar un mensaje


MLLT6 polyclonal antibody

MLLT6 polyclonal antibody